(data stored in ACNUC30630 zone)

EMBL: CP001738.PE359

CP001738.PE359       Location/Qualifiers
FT   CDS             402480..403217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0366"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rle:RL3033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95968"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2E8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95968.1"
FT                   /translation="MATRLVQIHMKAHDDSALGRFWAQALGWSLSSEGPGVTSLEPEGF
FT                   TYPDPTAVCIGIVADPSPKTVKNRVHLDLATTSAAHQADLVARLENLGATPVDIGQGDV
FT                   PWTVLADPEGNEFCVLEPRPVYRDTGPVAAVVVDCTDPRAMARFWGEAMDWTVHVVTDE
FT                   CAVLRSAKGVGPYLEFLRTPDAKTARNRIHLDLRPYPGDDQAAEVDRLRALGAVDIDIG
FT                   QGDVPWTVLADPEGNEFCVLTPM"
     MATRLVQIHM KAHDDSALGR FWAQALGWSL SSEGPGVTSL EPEGFTYPDP TAVCIGIVAD        60
     PSPKTVKNRV HLDLATTSAA HQADLVARLE NLGATPVDIG QGDVPWTVLA DPEGNEFCVL       120
     EPRPVYRDTG PVAAVVVDCT DPRAMARFWG EAMDWTVHVV TDECAVLRSA KGVGPYLEFL       180
     RTPDAKTARN RIHLDLRPYP GDDQAAEVDR LRALGAVDID IGQGDVPWTV LADPEGNEFC       240
     VLTPM                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page