(data stored in ACNUC30630 zone)

EMBL: CP001738.PE36

CP001738.PE36        Location/Qualifiers
FT   CDS             complement(41207..42205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0037"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; CHAP
FT                   domain containing protein; KEGG: mxa:MXAN_0560
FT                   penicillin-resistant dd- carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95645"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADD5"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ACY95645.1"
FT                   /translation="MGDASGMLAAARAALGMSGVPNAITLDYAGRHGEEFRKAAWCDMA
FT                   VTYWARKSGNEAAVLPGGDRAYTVWHAQDFQKIGRWYPGTVANVNRAEPGDIVFFDWGR
FT                   SDSIGAIDHVGVVEKVLGGGRVQTIEGNTGNAVKRRVRSADVIAGYGRPAYKPYKWNGK
FT                   APSGEPELKRGDTGDRVRDLQSALLKAGERLPEYGVDGDFGAETEAAVRSFQSKHPDEV
FT                   DRVTGRYGPQTAAALARALGHAAPDKPKPPAAKAPPWPGRYLKQPPIMRGDDVRRWQSQ
FT                   MRKRGWRLTVDGAYGPRSEQVCRAFQEEKGLAVDGVVGLVTWRQAWEAPIT"
     MGDASGMLAA ARAALGMSGV PNAITLDYAG RHGEEFRKAA WCDMAVTYWA RKSGNEAAVL        60
     PGGDRAYTVW HAQDFQKIGR WYPGTVANVN RAEPGDIVFF DWGRSDSIGA IDHVGVVEKV       120
     LGGGRVQTIE GNTGNAVKRR VRSADVIAGY GRPAYKPYKW NGKAPSGEPE LKRGDTGDRV       180
     RDLQSALLKA GERLPEYGVD GDFGAETEAA VRSFQSKHPD EVDRVTGRYG PQTAAALARA       240
     LGHAAPDKPK PPAAKAPPWP GRYLKQPPIM RGDDVRRWQS QMRKRGWRLT VDGAYGPRSE       300
     QVCRAFQEEK GLAVDGVVGL VTWRQAWEAP IT                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page