(data stored in ACNUC30630 zone)

EMBL: CP001738.PE361

CP001738.PE361       Location/Qualifiers
FT   CDS             404551..405279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95970"
FT                   /db_xref="GOA:D1A2F0"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2F0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95970.1"
FT                   /translation="MAAERVSGAGVTVVGRARWERALIWGGFPVAGAVLGGLVWLVAGW
FT                   VVALRWVPMRGPFELVDSLPDLPAALGCMGLGAVAGLVLAFVAEREYVTVAVGDDRVVC
FT                   VRDGAERSVPRASVGAVFVDEGRLVLLDRRGRELLVYSAREGADLPGTERLARAFKAHG
FT                   YPWSPGGDPHRDEYRRWVPDMPGLPSGANALLRARAKALDSGDGEEAAQLREELGRLGV
FT                   VVREDGKKRQFWRCVPPPLG"
     MAAERVSGAG VTVVGRARWE RALIWGGFPV AGAVLGGLVW LVAGWVVALR WVPMRGPFEL        60
     VDSLPDLPAA LGCMGLGAVA GLVLAFVAER EYVTVAVGDD RVVCVRDGAE RSVPRASVGA       120
     VFVDEGRLVL LDRRGRELLV YSAREGADLP GTERLARAFK AHGYPWSPGG DPHRDEYRRW       180
     VPDMPGLPSG ANALLRARAK ALDSGDGEEA AQLREELGRL GVVVREDGKK RQFWRCVPPP       240
     LG                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page