(data stored in ACNUC30630 zone)

EMBL: CP001738.PE364

CP001738.PE364       Location/Qualifiers
FT   CDS             complement(421434..421640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0372"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95973"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2F3"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ACY95973.1"
FT                   /translation="MAHYSVHDATWRRSSHSGSSGGECVEVAHLDSTTAIRDSKNPGAG
FT                   FLAMKREAWGRLLAEIKQGTYDF"
     MAHYSVHDAT WRRSSHSGSS GGECVEVAHL DSTTAIRDSK NPGAGFLAMK REAWGRLLAE        60
     IKQGTYDF                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page