(data stored in ACNUC30630 zone)

EMBL: CP001738.PE366

CP001738.PE366       Location/Qualifiers
FT   CDS             422747..423493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0374"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95975"
FT                   /db_xref="GOA:D1A2F5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2F5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95975.1"
FT                   /translation="MGHDQPPTLVTGGAHAWRLPPDERGPAMARSLLAQAMAALGLDQE
FT                   VIEDGRLAVSEIATNALRHARPAPGAAPVVPPELWVWARTVPAPQLVVSVFDGARSLPP
FT                   RPGRGGLLEESGKGLALVAEVAADWGYGPSRSLLADPPVPGKAVWFALPLPPDWPGRTV
FT                   TVHPDAAARCLMRVLARRGLHGRHSGTGALSVLELPGLNVWVLPGCFSWQPRPDRLIRH
FT                   PLIDLQETAERIIRHLDGSSSSMPAS"
     MGHDQPPTLV TGGAHAWRLP PDERGPAMAR SLLAQAMAAL GLDQEVIEDG RLAVSEIATN        60
     ALRHARPAPG AAPVVPPELW VWARTVPAPQ LVVSVFDGAR SLPPRPGRGG LLEESGKGLA       120
     LVAEVAADWG YGPSRSLLAD PPVPGKAVWF ALPLPPDWPG RTVTVHPDAA ARCLMRVLAR       180
     RGLHGRHSGT GALSVLELPG LNVWVLPGCF SWQPRPDRLI RHPLIDLQET AERIIRHLDG       240
     SSSSMPAS                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page