(data stored in ACNUC30630 zone)

EMBL: CP001738.PE368

CP001738.PE368       Location/Qualifiers
FT   CDS             complement(424733..427330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0376"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Lanthionine synthetase C family protein;
FT                   SMART: serine/threonine protein kinase; KEGG: smt:Smal_2130
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95977"
FT                   /db_xref="GOA:D1A2F7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2F7"
FT                   /inference="protein motif:PFAM:PF05147"
FT                   /protein_id="ACY95977.1"
FT                   /translation="MSHAPATPTEQELRAELTGPVTGAGRQIHARGVWLAVDDPAFHLP
FT                   RQGWKIHLSARPATLQETIRRMLPAVLAVPCHFKVVRSGRHLQDLNSANNHPGSIGKAV
FT                   TIYPSPEDVAPLARRLAEDLAGMAGPRICSDRRVRPDAPVYYRYGPFHPCYDINDDGDL
FT                   ELVVTDPQGNTHPGAADDSFWQPHWSPDPLTGATPHPAPSDGPAAPVLLGGRYRVVRGL
FT                   TRNGKGCVYRAIDTTDNRPVIIKEARAHVNEDTLGRDSRLRLRNERYVLHLLRDLDDVP
FT                   KVIDHFRHEDREYLAITDLGALALGQDVAENGLYVADPAPPGRSLRALATALLELLDHV
FT                   HRRGVLVRDLTPTNVVLDDATGRPRLVDFEISHAEDPQLYGWTPGYSPPEQERDEPATV
FT                   EADYYSLGATLFYAATGLPPTWMTGDPGNHDPRRAAEVLAGRGGMSGTILGLLDPDPAR
FT                   RRAAADDIRAGRFTDAPPPPPPSARQRARRLAAAIAHSLTELSRHAADLMSGKDFTGGL
FT                   VGSPINLYRGAAGMGMELLRHDEPSRALARGLAYWTGGFRALRNGRPGLYTGDTGIAVF
FT                   IAEAGATLGDETLLKIAEPLARPVLSRITATDQHTGLAGIGTGQLLLWRLTKDAGRLEL
FT                   ADACARRLLARDLTAELQENPPDYADCGAVSRTLGFAHGLAGIVHFLRDHHAATGETAT
FT                   EAALHKGCDTLLEHLPPLLEAARAVSAKPMHASFCQGLAGIGAALARTGRDLGADDHLQ
FT                   AAREAAAACLELAPRMYALTQCCGLAGIGELFLDLCQITGDRTYAQWADRIADLILARA
FT                   GGSPEAPVFPDTSLHGSSGGWSIGTSGVVSFLRRLGDPAAPRLWLDPPAGTAR"
     MSHAPATPTE QELRAELTGP VTGAGRQIHA RGVWLAVDDP AFHLPRQGWK IHLSARPATL        60
     QETIRRMLPA VLAVPCHFKV VRSGRHLQDL NSANNHPGSI GKAVTIYPSP EDVAPLARRL       120
     AEDLAGMAGP RICSDRRVRP DAPVYYRYGP FHPCYDINDD GDLELVVTDP QGNTHPGAAD       180
     DSFWQPHWSP DPLTGATPHP APSDGPAAPV LLGGRYRVVR GLTRNGKGCV YRAIDTTDNR       240
     PVIIKEARAH VNEDTLGRDS RLRLRNERYV LHLLRDLDDV PKVIDHFRHE DREYLAITDL       300
     GALALGQDVA ENGLYVADPA PPGRSLRALA TALLELLDHV HRRGVLVRDL TPTNVVLDDA       360
     TGRPRLVDFE ISHAEDPQLY GWTPGYSPPE QERDEPATVE ADYYSLGATL FYAATGLPPT       420
     WMTGDPGNHD PRRAAEVLAG RGGMSGTILG LLDPDPARRR AAADDIRAGR FTDAPPPPPP       480
     SARQRARRLA AAIAHSLTEL SRHAADLMSG KDFTGGLVGS PINLYRGAAG MGMELLRHDE       540
     PSRALARGLA YWTGGFRALR NGRPGLYTGD TGIAVFIAEA GATLGDETLL KIAEPLARPV       600
     LSRITATDQH TGLAGIGTGQ LLLWRLTKDA GRLELADACA RRLLARDLTA ELQENPPDYA       660
     DCGAVSRTLG FAHGLAGIVH FLRDHHAATG ETATEAALHK GCDTLLEHLP PLLEAARAVS       720
     AKPMHASFCQ GLAGIGAALA RTGRDLGADD HLQAAREAAA ACLELAPRMY ALTQCCGLAG       780
     IGELFLDLCQ ITGDRTYAQW ADRIADLILA RAGGSPEAPV FPDTSLHGSS GGWSIGTSGV       840
     VSFLRRLGDP AAPRLWLDPP AGTAR                                             865
//

If you have problems or comments...

PBIL Back to PBIL home page