(data stored in ACNUC30630 zone)

EMBL: CP001738.PE374

CP001738.PE374       Location/Qualifiers
FT   CDS             complement(432323..434074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0382"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: ade:Adeh_3450 WD-40
FT                   repeat-containing serine/threonin protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95983"
FT                   /db_xref="GOA:D1A2G3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2G3"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY95983.1"
FT                   /translation="MKQTWSLTEFTETRELGRGAQGRVVLARHRKSGALVAIKYLERAA
FT                   PEALAGLRAEAQMLGRLRSPHVVRLYQFVETPQGAAIVMEAVNGVSLRAILDKHGALAP
FT                   EAALTVLKGSLLGLAAAHSVGVVHRDYKPANVVVREDGLSKLVDFGVAALAGQGSSSGT
FT                   PAYMAPEQWRGEPASPATDVYAATGVFLECVTGRRPFAGVEAAALMHHHLNVPVPLNDV
FT                   PEPLRPLIARGMAKDPGQRPPGAAAFVAELEATARAAYGPDWERRGIGALAGAAVALAS
FT                   LFPLTALAVTPAGAAVAGGSVASSVGQGLLATAAGKVTIAVAGTAVVAASAGTVTYATR
FT                   DASPAPRPSPAAVVTTATESWTSANPRVVLQNAQYVRVSGLRDAALQQRINRALRAPLD
FT                   RLIKMGREHAVRSRTACEGRPTQIYSTVRLGVRGPALVSVRYRLWSDWCQAADGMPAGE
FT                   VVTIDLRTGRRLTATDVFRPQTLTPTGLSRLQSLVVQREPDPPWSNCAPEGRFTRKHFG
FT                   DWTAPAGDREPPMLSAFFTPSAFELAWHVSGSDGCQTLTFTAPYAKVRDLLQPSVLSLL
FT                   NPSPTPS"
     MKQTWSLTEF TETRELGRGA QGRVVLARHR KSGALVAIKY LERAAPEALA GLRAEAQMLG        60
     RLRSPHVVRL YQFVETPQGA AIVMEAVNGV SLRAILDKHG ALAPEAALTV LKGSLLGLAA       120
     AHSVGVVHRD YKPANVVVRE DGLSKLVDFG VAALAGQGSS SGTPAYMAPE QWRGEPASPA       180
     TDVYAATGVF LECVTGRRPF AGVEAAALMH HHLNVPVPLN DVPEPLRPLI ARGMAKDPGQ       240
     RPPGAAAFVA ELEATARAAY GPDWERRGIG ALAGAAVALA SLFPLTALAV TPAGAAVAGG       300
     SVASSVGQGL LATAAGKVTI AVAGTAVVAA SAGTVTYATR DASPAPRPSP AAVVTTATES       360
     WTSANPRVVL QNAQYVRVSG LRDAALQQRI NRALRAPLDR LIKMGREHAV RSRTACEGRP       420
     TQIYSTVRLG VRGPALVSVR YRLWSDWCQA ADGMPAGEVV TIDLRTGRRL TATDVFRPQT       480
     LTPTGLSRLQ SLVVQREPDP PWSNCAPEGR FTRKHFGDWT APAGDREPPM LSAFFTPSAF       540
     ELAWHVSGSD GCQTLTFTAP YAKVRDLLQP SVLSLLNPSP TPS                         583
//

If you have problems or comments...

PBIL Back to PBIL home page