(data stored in ACNUC30630 zone)

EMBL: CP001738.PE375

CP001738.PE375       Location/Qualifiers
FT   CDS             complement(434413..435402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swd:Swoo_2011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95984"
FT                   /db_xref="InterPro:IPR026935"
FT                   /db_xref="InterPro:IPR032369"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2G4"
FT                   /inference="similar to AA sequence:KEGG:Swoo_2011"
FT                   /protein_id="ACY95984.1"
FT                   /translation="MTTLIDIDARGMQHCETTALGVLLRHQGLDLSEPMLFGLGSGLSF
FT                   IYWDGKNLDFPFLGGRVKPFELTKNLAARLGLELAVHETSSPRKAWENVASAIDAGRPV
FT                   GLQLDSHHLDYFTPKVHFAGHIVAMYGYDDRTAYLVDTDSQGGAVTTSLDGLAQARAAR
FT                   GPMAAKHRSFTLTVPKDAPSPQSRIVPAITACADAFLNPPIANLGYRGIEKAGKLVRTW
FT                   LQRAGDPRRDLPQAAFLMEKGGTGGALFRNLYRDFLAECAQSIDSDHLRTGHRLYAEAA
FT                   TLWTETATLIAKAGESGDAQCLDQAGDLLGDLSRLEREAMQTLRRLAE"
     MTTLIDIDAR GMQHCETTAL GVLLRHQGLD LSEPMLFGLG SGLSFIYWDG KNLDFPFLGG        60
     RVKPFELTKN LAARLGLELA VHETSSPRKA WENVASAIDA GRPVGLQLDS HHLDYFTPKV       120
     HFAGHIVAMY GYDDRTAYLV DTDSQGGAVT TSLDGLAQAR AARGPMAAKH RSFTLTVPKD       180
     APSPQSRIVP AITACADAFL NPPIANLGYR GIEKAGKLVR TWLQRAGDPR RDLPQAAFLM       240
     EKGGTGGALF RNLYRDFLAE CAQSIDSDHL RTGHRLYAEA ATLWTETATL IAKAGESGDA       300
     QCLDQAGDLL GDLSRLEREA MQTLRRLAE                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page