(data stored in ACNUC30630 zone)

EMBL: CP001738.PE378

CP001738.PE378       Location/Qualifiers
FT   CDS             438229..438435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0386"
FT                   /product="MbtH domain protein"
FT                   /note="PFAM: MbtH domain protein; KEGG: bbt:BBta_4111
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95987"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2G7"
FT                   /inference="protein motif:PFAM:PF03621"
FT                   /protein_id="ACY95987.1"
FT                   /translation="MTNPFEDPEADYLVLVNAEGRHSLWPVFAAVPAGWSTAFGPDRRE
FT                   ACLEYVRTHWTDLRPRSLIEAHQ"
     MTNPFEDPEA DYLVLVNAEG RHSLWPVFAA VPAGWSTAFG PDRREACLEY VRTHWTDLRP        60
     RSLIEAHQ                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page