(data stored in ACNUC30630 zone)

EMBL: CP001738.PE379

CP001738.PE379       Location/Qualifiers
FT   CDS             438432..439175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0387"
FT                   /product="Siderophore-interacting protein"
FT                   /note="PFAM: Siderophore-interacting protein; FAD-binding 9
FT                   siderophore-interacting domain protein; KEGG: scl:sce3882
FT                   iron utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95988"
FT                   /db_xref="GOA:D1A2G8"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2G8"
FT                   /inference="protein motif:PFAM:PF04954"
FT                   /protein_id="ACY95988.1"
FT                   /translation="MSYRHFSAQVTRVTPLTPHMTRITLGGLEDFPGAGLDHRVKVFFP
FT                   LPGEDRPVYPTGDDWWERWQREPVRAVFRTYTIRRHRPELGEVDIDFVLHGDEGPGSRW
FT                   ASNARPGDHVGLWGPRAEYAPPPGTDWVLLAGDETALPAIGAILESLPRDATARVFVEV
FT                   ASPEERQHLDAPKGAEVRWVHRSDGESLLAAVREAGLPPGRPYAWVAAESSAVKQIRRH
FT                   LVDDRGIDREAIYFSGYWKRGAAQE"
     MSYRHFSAQV TRVTPLTPHM TRITLGGLED FPGAGLDHRV KVFFPLPGED RPVYPTGDDW        60
     WERWQREPVR AVFRTYTIRR HRPELGEVDI DFVLHGDEGP GSRWASNARP GDHVGLWGPR       120
     AEYAPPPGTD WVLLAGDETA LPAIGAILES LPRDATARVF VEVASPEERQ HLDAPKGAEV       180
     RWVHRSDGES LLAAVREAGL PPGRPYAWVA AESSAVKQIR RHLVDDRGID REAIYFSGYW       240
     KRGAAQE                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page