(data stored in ACNUC30630 zone)

EMBL: CP001738.PE383

CP001738.PE383       Location/Qualifiers
FT   CDS             443344..443808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0391"
FT                   /product="putative transcriptional regulator, PaaX family"
FT                   /note="PFAM: PaaX domain protein; KEGG: sme:SM_b21641
FT                   putative regulator of phenylacetic acid degradation, ArsR
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95992"
FT                   /db_xref="InterPro:IPR012906"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2H2"
FT                   /inference="protein motif:PFAM:PF07848"
FT                   /protein_id="ACY95992.1"
FT                   /translation="MTSAPAGERQVGLPRPRCGAKPRHLLVTLLGDYWSGRPEHLPSAA
FT                   LVALLGEFGISPAAARAALHRAGRGVVGAAEALRARTELMYDRLHFPGLDPKPPEELLP
FT                   DDWPRRRAHEVFGELYDAFGPPAEIRVRQTVARSAPELAPLVRHHTHRDS"
     MTSAPAGERQ VGLPRPRCGA KPRHLLVTLL GDYWSGRPEH LPSAALVALL GEFGISPAAA        60
     RAALHRAGRG VVGAAEALRA RTELMYDRLH FPGLDPKPPE ELLPDDWPRR RAHEVFGELY       120
     DAFGPPAEIR VRQTVARSAP ELAPLVRHHT HRDS                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page