(data stored in ACNUC30630 zone)

EMBL: CP001738.PE388

CP001738.PE388       Location/Qualifiers
FT   CDS             449638..449868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95997"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2H7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95997.1"
FT                   /translation="MVKASYRAALVGTVAAGCLAFGAAAAHADFGTSAEFRDNAFNVKV
FT                   DRQRVPDRTTDGNPVTALLGGLLGGNLPVLN"
     MVKASYRAAL VGTVAAGCLA FGAAAAHADF GTSAEFRDNA FNVKVDRQRV PDRTTDGNPV        60
     TALLGGLLGG NLPVLN                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page