(data stored in ACNUC30630 zone)

EMBL: CP001738.PE389

CP001738.PE389       Location/Qualifiers
FT   CDS             450432..451487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95998"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2H8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95998.1"
FT                   /translation="MGRHPIVVVDIKEFGRRPDGAQKQLRKRLYRVMWNALDAAGIVRE
FT                   DVHPPQDRGDGAFWILPTWVSPAELTGPLVRQLHRELQQDADSDPEGAMRVRVALHIGK
FT                   VSKDSNGWVGTDLNTACRLVDADELRRVLELGARPLMALILSRQWREEVRHRHIEGLDL
FT                   KSGWPVRIAVKEVADTAWIHLPGHEDLTVRLWRIQKRWEELLALEEQVRTRRDEIAERL
FT                   TSVPDMPDPPPELRRGRDLLPLWELVELDAEVFQQATERWWKRITKLGRRVEKMKAERD
FT                   ELRKTIEAFQARQNQSGLAEDLHLSAAYRRARDLLWHAPCDLPRAKAAVDDYIQEIWRK
FT                   LHHDLNAGGRA"
     MGRHPIVVVD IKEFGRRPDG AQKQLRKRLY RVMWNALDAA GIVREDVHPP QDRGDGAFWI        60
     LPTWVSPAEL TGPLVRQLHR ELQQDADSDP EGAMRVRVAL HIGKVSKDSN GWVGTDLNTA       120
     CRLVDADELR RVLELGARPL MALILSRQWR EEVRHRHIEG LDLKSGWPVR IAVKEVADTA       180
     WIHLPGHEDL TVRLWRIQKR WEELLALEEQ VRTRRDEIAE RLTSVPDMPD PPPELRRGRD       240
     LLPLWELVEL DAEVFQQATE RWWKRITKLG RRVEKMKAER DELRKTIEAF QARQNQSGLA       300
     EDLHLSAAYR RARDLLWHAP CDLPRAKAAV DDYIQEIWRK LHHDLNAGGR A                351
//

If you have problems or comments...

PBIL Back to PBIL home page