(data stored in ACNUC30630 zone)

EMBL: CP001738.PE39

CP001738.PE39        Location/Qualifiers
FT   CDS             complement(44316..44465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95648"
FT                   /db_xref="GOA:D1ADD8"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADD8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95648.1"
FT                   /translation="MTSNPPKTNPLPPGDRLLTVAEAAELLNTSERFPRRLIAERRIRF
FT                   VSAR"
     MTSNPPKTNP LPPGDRLLTV AEAAELLNTS ERFPRRLIAE RRIRFVSAR                    49
//

If you have problems or comments...

PBIL Back to PBIL home page