(data stored in ACNUC30630 zone)

EMBL: CP001738.PE401

CP001738.PE401       Location/Qualifiers
FT   CDS             complement(465188..465964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0410"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pzu:PHZ_c3387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96010"
FT                   /db_xref="GOA:D1A2J0"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2J0"
FT                   /inference="similar to AA sequence:KEGG:PHZ_c3387"
FT                   /protein_id="ACY96010.1"
FT                   /translation="MGTRFGELHRAGDPLVLPNAWDVASAVALAAAGFAAVGTTSLGVA
FT                   ARYGMADASRAIAEPVRRLAHRLRRLPCPVSVDIADGFADEPEAVAEYAASLGVDGVNI
FT                   EDSTAGRLVPVEVHAAKIAAVKERCPGLFVNARVDTFWVGQDATVTATIDRAVRYVEAG
FT                   ADGVFVPGRLDGAQIRQITSAVPVPVNVLASSDFSVAELARLGVRRVSCGSLLYRAALD
FT                   RAVEVAVGLRDGSPAPPATSYGDVQELATRYRPVCG"
     MGTRFGELHR AGDPLVLPNA WDVASAVALA AAGFAAVGTT SLGVAARYGM ADASRAIAEP        60
     VRRLAHRLRR LPCPVSVDIA DGFADEPEAV AEYAASLGVD GVNIEDSTAG RLVPVEVHAA       120
     KIAAVKERCP GLFVNARVDT FWVGQDATVT ATIDRAVRYV EAGADGVFVP GRLDGAQIRQ       180
     ITSAVPVPVN VLASSDFSVA ELARLGVRRV SCGSLLYRAA LDRAVEVAVG LRDGSPAPPA       240
     TSYGDVQELA TRYRPVCG                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page