(data stored in ACNUC30630 zone)

EMBL: CP001738.PE402

CP001738.PE402       Location/Qualifiers
FT   CDS             complement(466219..468042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_0583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96011"
FT                   /db_xref="InterPro:IPR025048"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2J1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96011.1"
FT                   /translation="MNSSSSRRKKESPIRFSFLDGEEESRWGADPVLAAGAGEAAFRRW
FT                   VQATCAADPSSVLVAVRPDRPAPGWAKVMFLEADPAHEKFLDAAYRSTLQPRHNGPVGT
FT                   EDLGGPPWTPPAEDDQAPAAPPGTSGGTDAPDLREPAPPVRAAVPQPAATGWYKIERPG
FT                   PLPEEAMFSGLLGRVVGEVHPYTEGDPVGVLATLLSALSAAVGHRPHIRLGSARHPLLV
FT                   WTMLIGRTALGRKGTATNAAMEIFQRVSADFTERHLLYGSPSSGAGLVGKLEAMAREAG
FT                   WYDEDGALHDAEPELRPGFPALMIEEEWAKVMRRSRIDDALGQNLRTAWQGNTLSVIVK
FT                   RKSDCATVKDAHLAIVGHITPDEFRANLSTADVAGGTFNRFLPVFVQRCQSLPLAEEMP
FT                   EALADRLAGELREAIARGRRLGLIRFDEAARDYWRDQLYDRLTALSTGSELIEAFAGRA
FT                   LPYAKRIAALYAVAAHQEMISLEHLQSAEAFITYVIASVEYIMATAAPPPSARARPGAA
FT                   KPHITRKVIEALLAAHPAPLSRSDLLAKVKNIGSTADLENSLASLGEDLQTSTARGGGR
FT                   PMRLYRLTEAAADRLGRRGGLTGAGDGGGRS"
     MNSSSSRRKK ESPIRFSFLD GEEESRWGAD PVLAAGAGEA AFRRWVQATC AADPSSVLVA        60
     VRPDRPAPGW AKVMFLEADP AHEKFLDAAY RSTLQPRHNG PVGTEDLGGP PWTPPAEDDQ       120
     APAAPPGTSG GTDAPDLREP APPVRAAVPQ PAATGWYKIE RPGPLPEEAM FSGLLGRVVG       180
     EVHPYTEGDP VGVLATLLSA LSAAVGHRPH IRLGSARHPL LVWTMLIGRT ALGRKGTATN       240
     AAMEIFQRVS ADFTERHLLY GSPSSGAGLV GKLEAMAREA GWYDEDGALH DAEPELRPGF       300
     PALMIEEEWA KVMRRSRIDD ALGQNLRTAW QGNTLSVIVK RKSDCATVKD AHLAIVGHIT       360
     PDEFRANLST ADVAGGTFNR FLPVFVQRCQ SLPLAEEMPE ALADRLAGEL REAIARGRRL       420
     GLIRFDEAAR DYWRDQLYDR LTALSTGSEL IEAFAGRALP YAKRIAALYA VAAHQEMISL       480
     EHLQSAEAFI TYVIASVEYI MATAAPPPSA RARPGAAKPH ITRKVIEALL AAHPAPLSRS       540
     DLLAKVKNIG STADLENSLA SLGEDLQTST ARGGGRPMRL YRLTEAAADR LGRRGGLTGA       600
     GDGGGRS                                                                 607
//

If you have problems or comments...

PBIL Back to PBIL home page