(data stored in ACNUC30630 zone)

EMBL: CP001738.PE404

CP001738.PE404       Location/Qualifiers
FT   CDS             complement(471149..472207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0413"
FT                   /product="AIR synthase related protein"
FT                   /note="PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: dal:Dalk_0686
FT                   thiamine-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96013"
FT                   /db_xref="GOA:D1A2J3"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2J3"
FT                   /inference="protein motif:PFAM:PF00586"
FT                   /protein_id="ACY96013.1"
FT                   /translation="MVWRARCVGRLATIIGPMFSGQTGWSHRLTGGETIRLLAGADAQD
FT                   DCAVFRLDGVQELVVGSDYVRGPKFGLYELGYLDDYDIGYYLAMANFSDIAAMGAQPIA
FT                   LLSVVRYPKTMPDERFAQVLQGINDACARVGAPNVGGDIGTAERLILSASAVGVVEAGR
FT                   SLLRGGARPGDRLCITGPTGVAAAAQKYFGKLDVADTRLSPQAEELLLNAWKRPQALVP
FT                   EGRSLSTSGLVTSCQDSSDGLKAGIESIAARSGVGFTVEEDALPVVGAVEEVAKLSDTE
FT                   LTPLLLGDSVDFQLIFTVPEEHVEELQEIFAAHGHSAFHDIGFATEEPDLLLRGSDGIT
FT                   RRLPGNPWRHAT"
     MVWRARCVGR LATIIGPMFS GQTGWSHRLT GGETIRLLAG ADAQDDCAVF RLDGVQELVV        60
     GSDYVRGPKF GLYELGYLDD YDIGYYLAMA NFSDIAAMGA QPIALLSVVR YPKTMPDERF       120
     AQVLQGINDA CARVGAPNVG GDIGTAERLI LSASAVGVVE AGRSLLRGGA RPGDRLCITG       180
     PTGVAAAAQK YFGKLDVADT RLSPQAEELL LNAWKRPQAL VPEGRSLSTS GLVTSCQDSS       240
     DGLKAGIESI AARSGVGFTV EEDALPVVGA VEEVAKLSDT ELTPLLLGDS VDFQLIFTVP       300
     EEHVEELQEI FAAHGHSAFH DIGFATEEPD LLLRGSDGIT RRLPGNPWRH AT               352
//

If you have problems or comments...

PBIL Back to PBIL home page