(data stored in ACNUC30630 zone)

EMBL: CP001738.PE408

CP001738.PE408       Location/Qualifiers
FT   CDS             477367..479589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0419"
FT                   /product="serine/threonine protein kinase with WD40
FT                   repeats"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; conserved hypothetical protein;
FT                   WD-40 repeat protein; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; WD-40 repeat protein;
FT                   KEGG: afw:Anae109_3558 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96017"
FT                   /db_xref="GOA:D1A2J7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2J7"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY96017.1"
FT                   /translation="MEPGLEIAGRYRLERSLGRGGFGEVWAAADMLRDRQVAIKFLYPQ
FT                   ISATNPVAVAKFRQEAKIAARLDHPGITRVDDFGLHEGQWFLVMEFLHGRTLAAELADH
FT                   PQGLPVPRVVALGEQLADALVAAHEMGVVHRDLKPVNLMVIDGDRLKVCDFGIARMADA
FT                   SVAVTFTGQVGTPLYMAPEQWLGEPTDHRTDLYAMGGILFHLLTGHPPFTADGARELMG
FT                   RHLNADPPRARTERPEIPVALDALIVELLAKDPRQRPARTADVRDRLRDIQQSRTSPPP
FT                   ASESTSAAPDDATRRLSPPPEPQSTSPAGSAAPGPTRPSVPESRSPAFDGAARPPSPPP
FT                   APGVRDTNGTRRPGGPRRVARRALLGGAVLSLAAAAAVPLSRLTARTGSDGRAGGTGSA
FT                   GTDDGDSPLRFTLKGHEKWVESVAFSPDGATLATASWDGTARLWNAKNGKPVATLEGHR
FT                   GEVISVAFSPDGATLATGSGDGTARLWNAKNGELIITLKGHQKAIGSVVFSPDGATLAT
FT                   ASWDNTVRLWNARSSELITALKGHKEVVQSVAFSPDGALLATASSDDTARLWRVRSGEL
FT                   ITALKGHRSTVASVVFSPDGATLATASRDGTARLWRAKDGELITVLKGHQDQVTSVAFS
FT                   PDGAALATAGWDGTARLWRVKDGEFIAILANHPEVWSVAFSPDGALLATANNKGIARLW
FT                   NARNGELITTLEGHHGGIGSVAFSPDGALLATASRDGTAKLWRVGD"
     MEPGLEIAGR YRLERSLGRG GFGEVWAAAD MLRDRQVAIK FLYPQISATN PVAVAKFRQE        60
     AKIAARLDHP GITRVDDFGL HEGQWFLVME FLHGRTLAAE LADHPQGLPV PRVVALGEQL       120
     ADALVAAHEM GVVHRDLKPV NLMVIDGDRL KVCDFGIARM ADASVAVTFT GQVGTPLYMA       180
     PEQWLGEPTD HRTDLYAMGG ILFHLLTGHP PFTADGAREL MGRHLNADPP RARTERPEIP       240
     VALDALIVEL LAKDPRQRPA RTADVRDRLR DIQQSRTSPP PASESTSAAP DDATRRLSPP       300
     PEPQSTSPAG SAAPGPTRPS VPESRSPAFD GAARPPSPPP APGVRDTNGT RRPGGPRRVA       360
     RRALLGGAVL SLAAAAAVPL SRLTARTGSD GRAGGTGSAG TDDGDSPLRF TLKGHEKWVE       420
     SVAFSPDGAT LATASWDGTA RLWNAKNGKP VATLEGHRGE VISVAFSPDG ATLATGSGDG       480
     TARLWNAKNG ELIITLKGHQ KAIGSVVFSP DGATLATASW DNTVRLWNAR SSELITALKG       540
     HKEVVQSVAF SPDGALLATA SSDDTARLWR VRSGELITAL KGHRSTVASV VFSPDGATLA       600
     TASRDGTARL WRAKDGELIT VLKGHQDQVT SVAFSPDGAA LATAGWDGTA RLWRVKDGEF       660
     IAILANHPEV WSVAFSPDGA LLATANNKGI ARLWNARNGE LITTLEGHHG GIGSVAFSPD       720
     GALLATASRD GTAKLWRVGD                                                   740
//

If you have problems or comments...

PBIL Back to PBIL home page