(data stored in ACNUC30630 zone)

EMBL: CP001738.PE418

CP001738.PE418       Location/Qualifiers
FT   CDS             486773..487363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0429"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96027"
FT                   /db_xref="GOA:D1A2K7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2K7"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACY96027.1"
FT                   /translation="MNVRKWECTNSPVRPLISAAWPPFGVTACEHEATEHNDAHPRPDT
FT                   DRPREVHMLTMIPRTCTAAPLYWRRTFPGEAAQARAARRFVACLLDGLPCLDEVVLTVD
FT                   ELVANALRHTKSGQAGGSFTVEVLAGPDGVAVAVADQGGPTEPAARDAADTDENGRGLR
FT                   TVSLTATSWGWHGNDSGRTVTAVFTAGAKERAQ"
     MNVRKWECTN SPVRPLISAA WPPFGVTACE HEATEHNDAH PRPDTDRPRE VHMLTMIPRT        60
     CTAAPLYWRR TFPGEAAQAR AARRFVACLL DGLPCLDEVV LTVDELVANA LRHTKSGQAG       120
     GSFTVEVLAG PDGVAVAVAD QGGPTEPAAR DAADTDENGR GLRTVSLTAT SWGWHGNDSG       180
     RTVTAVFTAG AKERAQ                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page