(data stored in ACNUC30630 zone)

EMBL: CP001738.PE423

CP001738.PE423       Location/Qualifiers
FT   CDS             490758..491621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mno:Mnod_6880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96032"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2L2"
FT                   /inference="protein motif:COG:COG3662"
FT                   /protein_id="ACY96032.1"
FT                   /translation="MTAPEEPVPPAPLGPGSFLWDYSGLRLAAITDISAFVLQAMHPAI
FT                   GAAAERLTDLDTRRLSRAVHDFVSIRPWVYGEQGTRHLLPAGPLAWAHLATFYVTVTAA
FT                   RYFSAEPMTLDREQRIFEEFLLLGRLRGVPARMLPSTMADYWAYFEDMLTHTLVPHPVA
FT                   HRVLDRLGGFSSTVPVTLRPLLVPFGLRGGWFTHLVTVGTLPQAARTKLGLTWTADDEH
FT                   RLRAVGTLFTRVLPHLPERLRYAPSAYQARRTSRMQRSPRGPRHLRLTDTCPVVAGCRG
FT                   VRRAVR"
     MTAPEEPVPP APLGPGSFLW DYSGLRLAAI TDISAFVLQA MHPAIGAAAE RLTDLDTRRL        60
     SRAVHDFVSI RPWVYGEQGT RHLLPAGPLA WAHLATFYVT VTAARYFSAE PMTLDREQRI       120
     FEEFLLLGRL RGVPARMLPS TMADYWAYFE DMLTHTLVPH PVAHRVLDRL GGFSSTVPVT       180
     LRPLLVPFGL RGGWFTHLVT VGTLPQAART KLGLTWTADD EHRLRAVGTL FTRVLPHLPE       240
     RLRYAPSAYQ ARRTSRMQRS PRGPRHLRLT DTCPVVAGCR GVRRAVR                     287
//

If you have problems or comments...

PBIL Back to PBIL home page