(data stored in ACNUC30630 zone)

EMBL: CP001738.PE426

CP001738.PE426       Location/Qualifiers
FT   CDS             complement(492693..494933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0437"
FT                   /product="glycosyl transferase family 39"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   acp:A2cp1_2390 transcriptional regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96035"
FT                   /db_xref="GOA:D1A2L5"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2L5"
FT                   /inference="protein motif:PFAM:PF02366"
FT                   /protein_id="ACY96035.1"
FT                   /translation="MTTIDSPSRPVRRPLLGRPEDPRWAGPGLLVLLAATAVLYLWGLG
FT                   ASGWANAYYSAAAQAGSVSWKAFFFGASDAAGAITVDKTPGALWPMALSARVFGVNSWS
FT                   ILVPQALMGVAAVGVLHAAVRRSLAAEAGPQVAAACGLLAGLVPATTPVAALMFRFNNP
FT                   DALLVLLLTLGAYAMVRSLEPGGLRWLLVAGGCVGLGFLAKMLQAFLVVPAFALVYLVA
FT                   APATVRRRIGHLLAAGAVMAVAAGWWVAIVTLIPADSRPYIGGSQHNSVLELTLGYNGL
FT                   GRLNGDEVGGLGNTDQDAGWGRMFGPVIGGQVSWLLPAALILPAAGLWATRRRARTDAV
FT                   RAALLLWGGWLAVHVLVFSHMRGIFHEYYTVALAPAIGALVGLGTGVLWRRPAGTAVLA
FT                   GTVAVTALWSYALLERTPDFVPWLRWAIVAAGVAAVALMAPGRSAPRLLGGGAALAVLA
FT                   SLAGPAAYAVETASTPHQGAIPIAGPQVSRGPGFPGDRFRRPPSLPDGIRPPQARRPAP
FT                   NSAPGGFGPGNGSSSSGSAGRTGGSGPDAGLGGPGSSSRSDRSGSDNDSGNSGSDGRSD
FT                   GLSPGDGSGGWPGGFGPGGGFGWFGPGRRPGGFGPRFGGFGPGGGMGGAGGLLNASTPS
FT                   AELTALLKADASAYTWVAAAVGSNRAAGYQLATGKPVMAVGGFNGTDPAPTLEQFQRYV
FT                   REKKIHYFIGGGMPGRAGSGSDAAQRIAEWVQENFTAQVIDGVTLYDLTAAR"
     MTTIDSPSRP VRRPLLGRPE DPRWAGPGLL VLLAATAVLY LWGLGASGWA NAYYSAAAQA        60
     GSVSWKAFFF GASDAAGAIT VDKTPGALWP MALSARVFGV NSWSILVPQA LMGVAAVGVL       120
     HAAVRRSLAA EAGPQVAAAC GLLAGLVPAT TPVAALMFRF NNPDALLVLL LTLGAYAMVR       180
     SLEPGGLRWL LVAGGCVGLG FLAKMLQAFL VVPAFALVYL VAAPATVRRR IGHLLAAGAV       240
     MAVAAGWWVA IVTLIPADSR PYIGGSQHNS VLELTLGYNG LGRLNGDEVG GLGNTDQDAG       300
     WGRMFGPVIG GQVSWLLPAA LILPAAGLWA TRRRARTDAV RAALLLWGGW LAVHVLVFSH       360
     MRGIFHEYYT VALAPAIGAL VGLGTGVLWR RPAGTAVLAG TVAVTALWSY ALLERTPDFV       420
     PWLRWAIVAA GVAAVALMAP GRSAPRLLGG GAALAVLASL AGPAAYAVET ASTPHQGAIP       480
     IAGPQVSRGP GFPGDRFRRP PSLPDGIRPP QARRPAPNSA PGGFGPGNGS SSSGSAGRTG       540
     GSGPDAGLGG PGSSSRSDRS GSDNDSGNSG SDGRSDGLSP GDGSGGWPGG FGPGGGFGWF       600
     GPGRRPGGFG PRFGGFGPGG GMGGAGGLLN ASTPSAELTA LLKADASAYT WVAAAVGSNR       660
     AAGYQLATGK PVMAVGGFNG TDPAPTLEQF QRYVREKKIH YFIGGGMPGR AGSGSDAAQR       720
     IAEWVQENFT AQVIDGVTLY DLTAAR                                            746
//

If you have problems or comments...

PBIL Back to PBIL home page