(data stored in ACNUC30630 zone)

EMBL: CP001738.PE440

CP001738.PE440       Location/Qualifiers
FT   CDS             514896..515861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0451"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: rec:RHECIAT_CH0002310 putative
FT                   phosphoglycerate dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96049"
FT                   /db_xref="GOA:D1A2M9"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2M9"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACY96049.1"
FT                   /translation="MRKPVAVYTDVVDTDPAPGVKLLEEAGFTVRFAASAAPADIVAAA
FT                   ADADALLLGYAEIDRPLLEALPAVRIVATQSVGYDMVDLDACRERGIWVTNVPGAATEE
FT                   VASHALAMTLALLRGLPYLDRDVRAGIWDGTRHDLRRLSEVTVGVVGLGRIGRRYAEYV
FT                   RPLVGRIVGYDPAVTAMHGVQWLALDELLACSDVVSLHLPLTAETRGLLDARRLGLMRE
FT                   GASLVNVSRAGLIDHRALVRCLDEGRLSGAALDVLPQEPPEPGDPILAHPRVLLTPHAA
FT                   YLSAASSRDYVLQQAENVVLWHARGRPVSVVVEGRPMAPR"
     MRKPVAVYTD VVDTDPAPGV KLLEEAGFTV RFAASAAPAD IVAAAADADA LLLGYAEIDR        60
     PLLEALPAVR IVATQSVGYD MVDLDACRER GIWVTNVPGA ATEEVASHAL AMTLALLRGL       120
     PYLDRDVRAG IWDGTRHDLR RLSEVTVGVV GLGRIGRRYA EYVRPLVGRI VGYDPAVTAM       180
     HGVQWLALDE LLACSDVVSL HLPLTAETRG LLDARRLGLM REGASLVNVS RAGLIDHRAL       240
     VRCLDEGRLS GAALDVLPQE PPEPGDPILA HPRVLLTPHA AYLSAASSRD YVLQQAENVV       300
     LWHARGRPVS VVVEGRPMAP R                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page