(data stored in ACNUC30630 zone)

EMBL: CP001738.PE446

CP001738.PE446       Location/Qualifiers
FT   CDS             522428..523369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0457"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: mxa:MXAN_5916 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96055"
FT                   /db_xref="GOA:D1A3D0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3D0"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACY96055.1"
FT                   /translation="MTPIPARHDLRGALAIGALVAITAIWGSTFPISKDLLTRLPVPDF
FT                   LALRFLTAALVVGLVRPRALPRAGWRVIGVGAALGLLYFIGQYLQFVGLQHTAPTVSAF
FT                   VVSMYVVFTPLLAALLTRKPPSRRTVVATLLATTGVAAMSLRGLAFGWGEMLTLFAASL
FT                   YAAHILALERWSRAQIAYTLTVVQLGTMGLAFLAVASIDGLQLPATRDVPVFLYLALLA
FT                   GGLALLGQTWAQAHLPAPTVSITLVLEPVWAGIISVLFFKERLDARIIIGAALILCALL
FT                   VITGRARNAPQDGLRRPQRRKVPRVPLLRRSR"
     MTPIPARHDL RGALAIGALV AITAIWGSTF PISKDLLTRL PVPDFLALRF LTAALVVGLV        60
     RPRALPRAGW RVIGVGAALG LLYFIGQYLQ FVGLQHTAPT VSAFVVSMYV VFTPLLAALL       120
     TRKPPSRRTV VATLLATTGV AAMSLRGLAF GWGEMLTLFA ASLYAAHILA LERWSRAQIA       180
     YTLTVVQLGT MGLAFLAVAS IDGLQLPATR DVPVFLYLAL LAGGLALLGQ TWAQAHLPAP       240
     TVSITLVLEP VWAGIISVLF FKERLDARII IGAALILCAL LVITGRARNA PQDGLRRPQR       300
     RKVPRVPLLR RSR                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page