(data stored in ACNUC30630 zone)

EMBL: CP001738.PE450

CP001738.PE450       Location/Qualifiers
FT   CDS             complement(530729..531109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96059"
FT                   /db_xref="GOA:D1A3D4"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3D4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96059.1"
FT                   /translation="MSTLRPAAGGLFTDGRRLLRAAALITGVNGPAYLALAGPLEDLLG
FT                   PAPGPSGRSCCSMRSPWGRCPRPPGSGAAPPRPSWRSTCCGRSSASRRPALNPAGRVWA
FT                   PLQAAVVAGFAAVQYAALRRTR"
     MSTLRPAAGG LFTDGRRLLR AAALITGVNG PAYLALAGPL EDLLGPAPGP SGRSCCSMRS        60
     PWGRCPRPPG SGAAPPRPSW RSTCCGRSSA SRRPALNPAG RVWAPLQAAV VAGFAAVQYA       120
     ALRRTR                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page