(data stored in ACNUC30630 zone)

EMBL: CP001738.PE460

CP001738.PE460       Location/Qualifiers
FT   CDS             complement(538817..539308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0472"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96069"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3E4"
FT                   /inference="protein motif:SMART:SM00450"
FT                   /protein_id="ACY96069.1"
FT                   /translation="MVTVRPPQARSIEEILQAARRRLDRLEPAEAHREFSRGQALLVDI
FT                   RPQAHRAAEGEVPGSLIIERNVLEWRFDPASPARLPQATGYDVRVIVLCAEGYTSSLAA
FT                   ASLHELGLTRATDVIGGYRAWRAAGLPTTGAPHAAAPDPTYPTLPPEPVMNARPARRSR
FT                   "
     MVTVRPPQAR SIEEILQAAR RRLDRLEPAE AHREFSRGQA LLVDIRPQAH RAAEGEVPGS        60
     LIIERNVLEW RFDPASPARL PQATGYDVRV IVLCAEGYTS SLAAASLHEL GLTRATDVIG       120
     GYRAWRAAGL PTTGAPHAAA PDPTYPTLPP EPVMNARPAR RSR                         163
//

If you have problems or comments...

PBIL Back to PBIL home page