(data stored in ACNUC30630 zone)

EMBL: CP001738.PE462

CP001738.PE462       Location/Qualifiers
FT   CDS             complement(540341..540568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96071"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3E6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96071.1"
FT                   /translation="MEIPLWVNYGQAYLMEKEAKPLVIHLDDETVIKAGSAYAYFLTGL
FT                   TRGSPAWTWRSPRRPRGESRRLWGRRGSES"
     MEIPLWVNYG QAYLMEKEAK PLVIHLDDET VIKAGSAYAY FLTGLTRGSP AWTWRSPRRP        60
     RGESRRLWGR RGSES                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page