(data stored in ACNUC30630 zone)

EMBL: CP001738.PE468

CP001738.PE468       Location/Qualifiers
FT   CDS             complement(545003..545383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96077"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3F2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96077.1"
FT                   /translation="MPKAQFRRKARALQRLGEENMLFKAINPVRPRDQNRRRAHQQDLI
FT                   RRIHRQYGQRNPDFSRRLISRITNARDMQLDHVHELQLGGADLRNNLRYLDAFTNREVG
FT                   NQIRQQIRNLPDGTPIRIRIIE"
     MPKAQFRRKA RALQRLGEEN MLFKAINPVR PRDQNRRRAH QQDLIRRIHR QYGQRNPDFS        60
     RRLISRITNA RDMQLDHVHE LQLGGADLRN NLRYLDAFTN REVGNQIRQQ IRNLPDGTPI       120
     RIRIIE                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page