(data stored in ACNUC30630 zone)

EMBL: CP001738.PE472

CP001738.PE472       Location/Qualifiers
FT   CDS             complement(547715..547864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96081"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3F6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96081.1"
FT                   /translation="MTDEAPGARYAIAVPSSALKAALRVPQRIRDLLRVTVYEVRDDLT
FT                   VKAH"
     MTDEAPGARY AIAVPSSALK AALRVPQRIR DLLRVTVYEV RDDLTVKAH                    49
//

If you have problems or comments...

PBIL Back to PBIL home page