(data stored in ACNUC30630 zone)

EMBL: CP001738.PE473

CP001738.PE473       Location/Qualifiers
FT   CDS             complement(548939..549130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0485"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96082"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3F7"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ACY96082.1"
FT                   /translation="MDTPKWRKSSRSNINGGDCVEVARLPYAIGIRDSKNPHHGHLTIT
FT                   PNAFRTLTHRIKRDEAHA"
     MDTPKWRKSS RSNINGGDCV EVARLPYAIG IRDSKNPHHG HLTITPNAFR TLTHRIKRDE        60
     AHA                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page