(data stored in ACNUC30630 zone)

EMBL: CP001738.PE480

CP001738.PE480       Location/Qualifiers
FT   CDS             complement(552609..553652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96089"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3G4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96089.1"
FT                   /translation="MGSFGGRDGWRPAGNCSLFACDIVGFSDPLRSDRAREHLHQKLYS
FT                   ILESAFAESGLPPESCYQEDRGDGALVLLPPELDPSLLVHPLIGLLRGKVLDHNELSAD
FT                   VAQIRLRVALHIGRAKANAKGIVGSDVNHLRRLLDAPPFKEEMAESGAVLGVLVSQEMY
FT                   DAVIRDARGLIDPEEFRPVEVHVKTTHATGWLRIPGDRRGLGGVRAGGGPSPPSPNGSS
FT                   QELVQAGRRPSQEPRAEVHIPGPNGEPALRPEVAGQFELVNRILAIPHMRTSEGRDDVV
FT                   DSLRQDIRIRIARRSRPQTDWLSIVRTCAEYPDGLEELIGLIHEYTGDTAQMMALRELV
FT                   ARMGWTN"
     MGSFGGRDGW RPAGNCSLFA CDIVGFSDPL RSDRAREHLH QKLYSILESA FAESGLPPES        60
     CYQEDRGDGA LVLLPPELDP SLLVHPLIGL LRGKVLDHNE LSADVAQIRL RVALHIGRAK       120
     ANAKGIVGSD VNHLRRLLDA PPFKEEMAES GAVLGVLVSQ EMYDAVIRDA RGLIDPEEFR       180
     PVEVHVKTTH ATGWLRIPGD RRGLGGVRAG GGPSPPSPNG SSQELVQAGR RPSQEPRAEV       240
     HIPGPNGEPA LRPEVAGQFE LVNRILAIPH MRTSEGRDDV VDSLRQDIRI RIARRSRPQT       300
     DWLSIVRTCA EYPDGLEELI GLIHEYTGDT AQMMALRELV ARMGWTN                     347
//

If you have problems or comments...

PBIL Back to PBIL home page