(data stored in ACNUC30630 zone)

EMBL: CP001738.PE494

CP001738.PE494       Location/Qualifiers
FT   CDS             570984..571961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0506"
FT                   /product="poly-gamma-glutamate biosynthesis protein"
FT                   /note="KEGG: gur:Gura_2950 poly-gamma-glutamate
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96103"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3H8"
FT                   /inference="similar to AA sequence:KEGG:Gura_2950"
FT                   /protein_id="ACY96103.1"
FT                   /translation="MSITLALAGDAMLGRDVAKRLGVAASHDLFSTAVRDWFATADLAV
FT                   LNLECCISERGAPWRSPGKLFHFRAPAKAAQALAWLGIDCVTLANNHALDFGPDALLDT
FT                   CEHLQNAGIETVGAGPDAEHARAGVILQARGMRLGVLGLTDHPADMAAGPDRPGVAYAD
FT                   LSCGVPDWVRERIADLRARCDAVLVTPHWGPNMTAEPLPYVRRAARQLLEAGATLVAGH
FT                   SAHVFHGVDGPILYDLGDFIDDYAVDAQLHNDLGLLWLVTLDAAGPREITAVPLALDYC
FT                   RTRLAVEHERAWIRDRLRAASAEFGTPVEERDGVLTMRVAVPAR"
     MSITLALAGD AMLGRDVAKR LGVAASHDLF STAVRDWFAT ADLAVLNLEC CISERGAPWR        60
     SPGKLFHFRA PAKAAQALAW LGIDCVTLAN NHALDFGPDA LLDTCEHLQN AGIETVGAGP       120
     DAEHARAGVI LQARGMRLGV LGLTDHPADM AAGPDRPGVA YADLSCGVPD WVRERIADLR       180
     ARCDAVLVTP HWGPNMTAEP LPYVRRAARQ LLEAGATLVA GHSAHVFHGV DGPILYDLGD       240
     FIDDYAVDAQ LHNDLGLLWL VTLDAAGPRE ITAVPLALDY CRTRLAVEHE RAWIRDRLRA       300
     ASAEFGTPVE ERDGVLTMRV AVPAR                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page