(data stored in ACNUC30630 zone)

EMBL: CP001738.PE495

CP001738.PE495       Location/Qualifiers
FT   CDS             572101..573006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0507"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   rpb:RPB_4412 luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96104"
FT                   /db_xref="GOA:D1A3H9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019910"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3H9"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACY96104.1"
FT                   /translation="MRIGIVLNEPSGPDALHRLRDELRRAADDGFASAWVTQIFGVDAL
FT                   TALAVAGSQVPGIEVGTSVVPTYPRHPAVLAQQALTAALALDGRLTLGIGLSHQVVIEA
FT                   MYGLDYSRPLKHMSEYLSVLLPLLDGEPAQFTGETLAGNITLSTPRTGRVPVVVAALGP
FT                   RMLKLAGSRTDGTVTWMTGPVTLRDHIVPTIIAAAQEAGRPAPRVVAILPVCVTDDVDA
FT                   ARQRAAKVYQVYGTLPSYRAMLEREGVAAPEDVAIIGDEDTVGARIRALADYGVTDFVA
FT                   GDFSKGKDSERTRALLTSLL"
     MRIGIVLNEP SGPDALHRLR DELRRAADDG FASAWVTQIF GVDALTALAV AGSQVPGIEV        60
     GTSVVPTYPR HPAVLAQQAL TAALALDGRL TLGIGLSHQV VIEAMYGLDY SRPLKHMSEY       120
     LSVLLPLLDG EPAQFTGETL AGNITLSTPR TGRVPVVVAA LGPRMLKLAG SRTDGTVTWM       180
     TGPVTLRDHI VPTIIAAAQE AGRPAPRVVA ILPVCVTDDV DAARQRAAKV YQVYGTLPSY       240
     RAMLEREGVA APEDVAIIGD EDTVGARIRA LADYGVTDFV AGDFSKGKDS ERTRALLTSL       300
     L                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page