(data stored in ACNUC30630 zone)

EMBL: CP001738.PE502

CP001738.PE502       Location/Qualifiers
FT   CDS             complement(579485..580507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0514"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   ftm:FTM_0312 ABC transporter, periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96111"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3I6"
FT                   /inference="protein motif:TFAM:TIGR00996"
FT                   /protein_id="ACY96111.1"
FT                   /translation="MRRSAAVATALAVTLAAGGTGCSVQTAGAPKGGMTLSATFEDVQT
FT                   LTTGHSVQISDVKVGTVTKIELSGYRALVTMSLEKGRRIPTGTTATISRTSLLGENYVR
FT                   LDPPPGRDLSTGPFLPDGAHLSATSVQPDLEQITERVGPLLAAISGQNLQTITSEGATA
FT                   VSGKGKQLNTLIKKAAQVTDSYAAANADLARALDALAELGGTLEGGRDRLDKLPGNLQL
FT                   ATQRLKNERAQLKRSVQELLKLARSINDNVHLRHGKRLEAVLRRAEELIDAAVRGREQL
FT                   KALTLSILKLLKGPSVSYSGQALVMVWLKGFLPPAGGASASQGRADSGGPLRDLLEPRS
FT                   "
     MRRSAAVATA LAVTLAAGGT GCSVQTAGAP KGGMTLSATF EDVQTLTTGH SVQISDVKVG        60
     TVTKIELSGY RALVTMSLEK GRRIPTGTTA TISRTSLLGE NYVRLDPPPG RDLSTGPFLP       120
     DGAHLSATSV QPDLEQITER VGPLLAAISG QNLQTITSEG ATAVSGKGKQ LNTLIKKAAQ       180
     VTDSYAAANA DLARALDALA ELGGTLEGGR DRLDKLPGNL QLATQRLKNE RAQLKRSVQE       240
     LLKLARSIND NVHLRHGKRL EAVLRRAEEL IDAAVRGREQ LKALTLSILK LLKGPSVSYS       300
     GQALVMVWLK GFLPPAGGAS ASQGRADSGG PLRDLLEPRS                             340
//

If you have problems or comments...

PBIL Back to PBIL home page