(data stored in ACNUC30630 zone)

EMBL: CP001738.PE508

CP001738.PE508       Location/Qualifiers
FT   CDS             complement(585508..586296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0520"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   dvl:Dvul_1816 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96117"
FT                   /db_xref="GOA:D1A3J2"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3J2"
FT                   /inference="protein motif:PFAM:PF02405"
FT                   /protein_id="ACY96117.1"
FT                   /translation="MVMAQVPVRIHGLLNQVGELFVVALEGLRRTWDVRTWFWEFVEQC
FT                   WFLARVTSIPVILVALPLGATVALQVGQVAAQLGAQSATGGAVIVGLVREVAPIAAAMI
FT                   IAGAGGSAMTADMGTRRIRDELDAMEVMAINPIHRLVTPRLWAASLISTLLVSLVVLSG
FT                   AAGGFVFNVLLQDVTPGAYFDGATSLLQTSDLVVTLLKAWLFGMIAGIVACYMGMNCAS
FT                   TPVGVGRAVNQAIVVAFLLVFALNYVITTVYFIAYPPKIG"
     MVMAQVPVRI HGLLNQVGEL FVVALEGLRR TWDVRTWFWE FVEQCWFLAR VTSIPVILVA        60
     LPLGATVALQ VGQVAAQLGA QSATGGAVIV GLVREVAPIA AAMIIAGAGG SAMTADMGTR       120
     RIRDELDAME VMAINPIHRL VTPRLWAASL ISTLLVSLVV LSGAAGGFVF NVLLQDVTPG       180
     AYFDGATSLL QTSDLVVTLL KAWLFGMIAG IVACYMGMNC ASTPVGVGRA VNQAIVVAFL       240
     LVFALNYVIT TVYFIAYPPK IG                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page