(data stored in ACNUC30630 zone)

EMBL: CP001738.PE509

CP001738.PE509       Location/Qualifiers
FT   CDS             586825..587028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0521"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: mxa:MXAN_1617 cold-shock protein CspA"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96118"
FT                   /db_xref="GOA:D1A3J3"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3J3"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACY96118.1"
FT                   /translation="MAQGTVKWFNPDKGFGFISPDDGSADIFVHHSAIQMRGFRTLVEE
FT                   QRVEYTAVQGPKGLQADVVRAL"
     MAQGTVKWFN PDKGFGFISP DDGSADIFVH HSAIQMRGFR TLVEEQRVEY TAVQGPKGLQ        60
     ADVVRAL                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page