(data stored in ACNUC30630 zone)

EMBL: CP001738.PE51

CP001738.PE51        Location/Qualifiers
FT   CDS             52347..53258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0052"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   scl:sce5487 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95660"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADF0"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ACY95660.1"
FT                   /translation="MSIRDFAAHLGVSERMVSKWEKEAENIHPRPVNQQALDSSLAAST
FT                   PEEQERFAALVGETVQHTPAAVPDTQASAPPGEPLPLNEPHQVRHPIDGKLMTLVDAGV
FT                   FLAGEKDEPVYLPAFYIDVFPTTNADYARFVAATGHPAPQHWKDNSPPDNLLDHPVVFV
FT                   TWHDATAYAQWTAKALPTSQQWEKAARGTRGDTYPWGSQLTPAKCNVRESGIRTTTPVN
FT                   RYHSGVSPYGVYDMCGNVWEWCSTQSEPGRYELKGSAFTSPFKRCTPANFNDASADMLD
FT                   DDTGFRCVTPAETMRALLKMNS"
     MSIRDFAAHL GVSERMVSKW EKEAENIHPR PVNQQALDSS LAASTPEEQE RFAALVGETV        60
     QHTPAAVPDT QASAPPGEPL PLNEPHQVRH PIDGKLMTLV DAGVFLAGEK DEPVYLPAFY       120
     IDVFPTTNAD YARFVAATGH PAPQHWKDNS PPDNLLDHPV VFVTWHDATA YAQWTAKALP       180
     TSQQWEKAAR GTRGDTYPWG SQLTPAKCNV RESGIRTTTP VNRYHSGVSP YGVYDMCGNV       240
     WEWCSTQSEP GRYELKGSAF TSPFKRCTPA NFNDASADML DDDTGFRCVT PAETMRALLK       300
     MNS                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page