(data stored in ACNUC30630 zone)

EMBL: CP001738.PE513

CP001738.PE513       Location/Qualifiers
FT   CDS             590487..590792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0525"
FT                   /product="monooxygenase component MmoB/DmpM"
FT                   /note="PFAM: monooxygenase component MmoB/DmpM; KEGG:
FT                   reu:Reut_B5682 monooxygenase component MmoB/DmpM"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96122"
FT                   /db_xref="GOA:D1A3J7"
FT                   /db_xref="InterPro:IPR003454"
FT                   /db_xref="InterPro:IPR036889"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3J7"
FT                   /inference="protein motif:PFAM:PF02406"
FT                   /protein_id="ACY96122.1"
FT                   /translation="MTGTAPATGRPRTVGVDLQQNNEETRYVVEAIAKDNPDATIRHLP
FT                   GLIKIQTPGTLVIRRETVEELLGRPWETHEFQLSIVSYYGHVDEWDDDQIVIKWSH"
     MTGTAPATGR PRTVGVDLQQ NNEETRYVVE AIAKDNPDAT IRHLPGLIKI QTPGTLVIRR        60
     ETVEELLGRP WETHEFQLSI VSYYGHVDEW DDDQIVIKWS H                           101
//

If you have problems or comments...

PBIL Back to PBIL home page