(data stored in ACNUC30630 zone)

EMBL: CP001738.PE52

CP001738.PE52        Location/Qualifiers
FT   CDS             55118..55831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0053"
FT                   /product="nucleotidyltransferase-like protein"
FT                   /note="KEGG: scl:sce7146 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95661"
FT                   /db_xref="GOA:D1ADF1"
FT                   /db_xref="InterPro:IPR018775"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADF1"
FT                   /inference="protein motif:COG:COG3541"
FT                   /protein_id="ACY95661.1"
FT                   /translation="MTDTLLLTGVVGSTAYGLAGADSDVDVLGVYAAPTTVFHGLHPPT
FT                   ERTATKVSTDPDRTLHEAGKFARLCLSGNPTVTELLWLPEELYQVRTPLGEELIGIRTA
FT                   FLSAPRVRDAYLGYATRQFRRLEARGDGSFSADTRKRVAKHARHLARLVHQGLELYRSG
FT                   RLTVRLADPEWYLDFGARVAAGDLDVARALMARGEADYAAARTVLPERPDEDAVERWLL
FT                   RVRAAHYTHPCCKGD"
     MTDTLLLTGV VGSTAYGLAG ADSDVDVLGV YAAPTTVFHG LHPPTERTAT KVSTDPDRTL        60
     HEAGKFARLC LSGNPTVTEL LWLPEELYQV RTPLGEELIG IRTAFLSAPR VRDAYLGYAT       120
     RQFRRLEARG DGSFSADTRK RVAKHARHLA RLVHQGLELY RSGRLTVRLA DPEWYLDFGA       180
     RVAAGDLDVA RALMARGEAD YAAARTVLPE RPDEDAVERW LLRVRAAHYT HPCCKGD          237
//

If you have problems or comments...

PBIL Back to PBIL home page