(data stored in ACNUC30630 zone)

EMBL: CP001738.PE524

CP001738.PE524       Location/Qualifiers
FT   CDS             599464..600531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0536"
FT                   /product="4-hydroxy-2-oxovalerate aldolase"
FT                   /note="TIGRFAM: 4-hydroxy-2-oxovalerate aldolase; PFAM:
FT                   pyruvate carboxyltransferase; DmpG communication domain
FT                   protein; KEGG: reh:H16_A1807 4-hydroxy-2-oxovalerate
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96133"
FT                   /db_xref="GOA:D1A3K8"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017629"
FT                   /db_xref="InterPro:IPR035685"
FT                   /db_xref="PDB:4LRS"
FT                   /db_xref="PDB:4LRT"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3K8"
FT                   /inference="protein motif:TFAM:TIGR03217"
FT                   /protein_id="ACY96133.1"
FT                   /translation="MTDQDGATAAPRVRITDSTLRDGSHAMAHQFTEEQVRATVHALDA
FT                   AGVEVIEVSHGDGLGGSSFNYGFSAVDEIDLVAAAVDEAVNAKIAVLLLPGVGTVRDLK
FT                   RAHDAGASVARIATHCTEADVSCQHFAAARELGMETVGFLMLAHRIGPEELARQARIMV
FT                   DAGAQCVYVVDSAGALVLSDVQARVQALVREIGHEAQVGFHGHQNLSLGVANSVLAYQN
FT                   GARQIDGALCALGAGAGNSPTEILAATFERLNIETGVNVQAALAAAEEVVRPYLPRLPW
FT                   ADRAAIVQGYAGVYSSFLLHAERAAERYGVPAHEILQRVGEAGYVGGQEDMIIDIAVQL
FT                   AEERHGRPAPAGGRR"
     MTDQDGATAA PRVRITDSTL RDGSHAMAHQ FTEEQVRATV HALDAAGVEV IEVSHGDGLG        60
     GSSFNYGFSA VDEIDLVAAA VDEAVNAKIA VLLLPGVGTV RDLKRAHDAG ASVARIATHC       120
     TEADVSCQHF AAARELGMET VGFLMLAHRI GPEELARQAR IMVDAGAQCV YVVDSAGALV       180
     LSDVQARVQA LVREIGHEAQ VGFHGHQNLS LGVANSVLAY QNGARQIDGA LCALGAGAGN       240
     SPTEILAATF ERLNIETGVN VQAALAAAEE VVRPYLPRLP WADRAAIVQG YAGVYSSFLL       300
     HAERAAERYG VPAHEILQRV GEAGYVGGQE DMIIDIAVQL AEERHGRPAP AGGRR            355
//

If you have problems or comments...

PBIL Back to PBIL home page