(data stored in ACNUC30630 zone)

EMBL: CP001738.PE527

CP001738.PE527       Location/Qualifiers
FT   CDS             601549..602985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0539"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: ara:Arad_7263
FT                   betaine aldehyde dehydrogenase (BADH) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96136"
FT                   /db_xref="GOA:D1A3L1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3L1"
FT                   /inference="protein motif:PRIAM:1.2.1.8"
FT                   /protein_id="ACY96136.1"
FT                   /translation="MDFYGHVIDGEEVPSADGAEFDSIDPYRREPWARVALGSATDVDR
FT                   AVRAARRAFDEGPWPRMGLAERGAVLHRLADLLERNAEEMGLSDTRDMGKPITQSRDND
FT                   VFRSAANLRFFADHARLSTAETLPMDSGHHAYTRFEPAGVVAAIAPWNYPLMLATWKVA
FT                   PALAWGNTVVLKPAEDSPVSATKLARLALEAGMPPGVLNVVHGRGPDSAGQALTEHPGI
FT                   DRITFTGASSTGRVIARAAAANLVPVSLELGGKGANVVFADADLANAVEWSIKAVYTNT
FT                   GQVCLAGSRIYVQRPIYEEFLARFVAAAEAMVIGDPCDAATQIGPLASEQHYRKVRGYV
FT                   ETVESAGGKILTGGLGDGWTVRPTVVVDMPQTAPHCTEEIFGPLVVISPFDTEQEAVEL
FT                   ANNTRYGLNAMVFTENLHRAHRVSARLRAGTVWVNCFFIRDLRAPFGGVGDSGVGREGG
FT                   SFSREFFTEPKAVIIDVKRD"
     MDFYGHVIDG EEVPSADGAE FDSIDPYRRE PWARVALGSA TDVDRAVRAA RRAFDEGPWP        60
     RMGLAERGAV LHRLADLLER NAEEMGLSDT RDMGKPITQS RDNDVFRSAA NLRFFADHAR       120
     LSTAETLPMD SGHHAYTRFE PAGVVAAIAP WNYPLMLATW KVAPALAWGN TVVLKPAEDS       180
     PVSATKLARL ALEAGMPPGV LNVVHGRGPD SAGQALTEHP GIDRITFTGA SSTGRVIARA       240
     AAANLVPVSL ELGGKGANVV FADADLANAV EWSIKAVYTN TGQVCLAGSR IYVQRPIYEE       300
     FLARFVAAAE AMVIGDPCDA ATQIGPLASE QHYRKVRGYV ETVESAGGKI LTGGLGDGWT       360
     VRPTVVVDMP QTAPHCTEEI FGPLVVISPF DTEQEAVELA NNTRYGLNAM VFTENLHRAH       420
     RVSARLRAGT VWVNCFFIRD LRAPFGGVGD SGVGREGGSF SREFFTEPKA VIIDVKRD         478
//

If you have problems or comments...

PBIL Back to PBIL home page