(data stored in ACNUC30630 zone)

EMBL: CP001738.PE546

CP001738.PE546       Location/Qualifiers
FT   CDS             626418..626744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96155"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3N0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96155.1"
FT                   /translation="MTASLDGLELFPWEVRGEDGEIHESGVSGDWAAASRAAIRALETR
FT                   PAGWTACVWSARLNPLEYDYRKVIGRGSGKQARPGSSGGPAGAAARFPTRRAAAPQRRG
FT                   IRRG"
     MTASLDGLEL FPWEVRGEDG EIHESGVSGD WAAASRAAIR ALETRPAGWT ACVWSARLNP        60
     LEYDYRKVIG RGSGKQARPG SSGGPAGAAA RFPTRRAAAP QRRGIRRG                    108
//

If you have problems or comments...

PBIL Back to PBIL home page