(data stored in ACNUC30630 zone)

EMBL: CP001738.PE549

CP001738.PE549       Location/Qualifiers
FT   CDS             628292..628885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0561"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: pmy:Pmen_1681
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96158"
FT                   /db_xref="GOA:D1A3N3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR040611"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3N3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACY96158.1"
FT                   /translation="MTRYRESVRSLLRERLLDAAYELVAADGWDKMRMTRLAIAAGVSR
FT                   QTVYTEFGSREAIGEALIMREVERFLVGIQEQLDANTADLRAAITAGVRFTLQQAADNP
FT                   LIKSVLTNARSGNEGLLALLTVRSDQLLNAAQTMLDAYVADVWPEMDPASRSLAIEAVV
FT                   RITLSHIVQPGGSAEETARRTAEIVMRVAQISDD"
     MTRYRESVRS LLRERLLDAA YELVAADGWD KMRMTRLAIA AGVSRQTVYT EFGSREAIGE        60
     ALIMREVERF LVGIQEQLDA NTADLRAAIT AGVRFTLQQA ADNPLIKSVL TNARSGNEGL       120
     LALLTVRSDQ LLNAAQTMLD AYVADVWPEM DPASRSLAIE AVVRITLSHI VQPGGSAEET       180
     ARRTAEIVMR VAQISDD                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page