(data stored in ACNUC30630 zone)

EMBL: CP001738.PE55

CP001738.PE55        Location/Qualifiers
FT   CDS             complement(58692..59114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95664"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADF4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95664.1"
FT                   /translation="MSPLISVRRRPQVEVDASPLRRMQEAARQGAVTAAVRLGPAMRHS
FT                   REFAAERLLEARGWSAPRLERAAGYVERDLAPRLSAMLADTAHRLEPPKPANRARNAAL
FT                   VMLGMIAAAGAAGALASRRSAAHTLGERMPEPTTTP"
     MSPLISVRRR PQVEVDASPL RRMQEAARQG AVTAAVRLGP AMRHSREFAA ERLLEARGWS        60
     APRLERAAGY VERDLAPRLS AMLADTAHRL EPPKPANRAR NAALVMLGMI AAAGAAGALA       120
     SRRSAAHTLG ERMPEPTTTP                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page