(data stored in ACNUC30630 zone)

EMBL: CP001738.PE557

CP001738.PE557       Location/Qualifiers
FT   CDS             641842..642417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0571"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce5972 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96166"
FT                   /db_xref="InterPro:IPR018700"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3P1"
FT                   /inference="similar to AA sequence:KEGG:sce5972"
FT                   /protein_id="ACY96166.1"
FT                   /translation="MSQADPGIDGGALISTLKRAAGVLRDAGVEFALAGGFAAYVRGAA
FT                   ISTHDVDFVLREQDVDAAVSALTAAGMRHRECPEEWLTKVYDGDRPIDLIFRPSGRPVD
FT                   GGMLQRAEELPVAAVSMPVLPADDLVIMRLLAFTETACDFSDFLHVCRALREQVDWPKV
FT                   AKETAHSPYAYAFLTLLHRLDVIEGGFL"
     MSQADPGIDG GALISTLKRA AGVLRDAGVE FALAGGFAAY VRGAAISTHD VDFVLREQDV        60
     DAAVSALTAA GMRHRECPEE WLTKVYDGDR PIDLIFRPSG RPVDGGMLQR AEELPVAAVS       120
     MPVLPADDLV IMRLLAFTET ACDFSDFLHV CRALREQVDW PKVAKETAHS PYAYAFLTLL       180
     HRLDVIEGGF L                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page