(data stored in ACNUC30630 zone)

EMBL: CP001738.PE568

CP001738.PE568       Location/Qualifiers
FT   CDS             651098..651529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0582"
FT                   /product="Class I peptide chain release factor"
FT                   /note="PFAM: Class I peptide chain release factor; KEGG:
FT                   xop:PXO_02765 peptidyl-tRNA hydrolase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96177"
FT                   /db_xref="GOA:D1A4E2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4E2"
FT                   /inference="protein motif:PFAM:PF00472"
FT                   /protein_id="ACY96177.1"
FT                   /translation="MPPAIRVRGSVTIPETELRWRFSRSSGPGGQHVNTSATAAELSFD
FT                   VAGSPSLPEPYKRRALERLAGRLNGGVLTIRAEEHRSQKLNRDAARARLAALLTEATAP
FT                   PPKKRRPTKPSRRVHKRRLENKRRRGALKRERSSRWHWH"
     MPPAIRVRGS VTIPETELRW RFSRSSGPGG QHVNTSATAA ELSFDVAGSP SLPEPYKRRA        60
     LERLAGRLNG GVLTIRAEEH RSQKLNRDAA RARLAALLTE ATAPPPKKRR PTKPSRRVHK       120
     RRLENKRRRG ALKRERSSRW HWH                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page