(data stored in ACNUC30630 zone)

EMBL: CP001738.PE57

CP001738.PE57        Location/Qualifiers
FT   CDS             59939..60847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0058"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: nmu:Nmul_A2462
FT                   rhomboid-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95666"
FT                   /db_xref="GOA:D1ADF6"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADF6"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACY95666.1"
FT                   /translation="MDAQAPGAPAEAPTCYRHPGRETYVRCTRCDRYICPDCMRDAAVG
FT                   HQCVECVQEGSRTVRRPRTVFGGQIPATPVVTYTLIALNVLVYLAQLSSSRIVYDFAMV
FT                   GVRFDPYGEMHGVADGEWYRLITAAFLHSQPGGGSFGVTHILFNMWALWVIGPQLEQVL
FT                   GRWRFTSLYLLSALGGSVLLYLVDPTGAAVGASGAIFGLFGAFFVIAKRLNAPAGGIVF
FT                   LLVLNLVITFTVPGISWEGHIGGLLTGGLLTAVYAYLPRVQGSDHQRRTVIHAVAVAAL
FT                   LALFIALVAVKTSELTGLLSF"
     MDAQAPGAPA EAPTCYRHPG RETYVRCTRC DRYICPDCMR DAAVGHQCVE CVQEGSRTVR        60
     RPRTVFGGQI PATPVVTYTL IALNVLVYLA QLSSSRIVYD FAMVGVRFDP YGEMHGVADG       120
     EWYRLITAAF LHSQPGGGSF GVTHILFNMW ALWVIGPQLE QVLGRWRFTS LYLLSALGGS       180
     VLLYLVDPTG AAVGASGAIF GLFGAFFVIA KRLNAPAGGI VFLLVLNLVI TFTVPGISWE       240
     GHIGGLLTGG LLTAVYAYLP RVQGSDHQRR TVIHAVAVAA LLALFIALVA VKTSELTGLL       300
     SF                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page