(data stored in ACNUC30630 zone)

EMBL: CP001738.PE579

CP001738.PE579       Location/Qualifiers
FT   CDS             complement(663713..664819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0593"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /note="TIGRFAM: phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: sml:Smlt1552
FT                   putative phosphate transport system, substrate-binding
FT                   exported periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96188"
FT                   /db_xref="GOA:D1A4F3"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4F3"
FT                   /inference="protein motif:TFAM:TIGR00975"
FT                   /protein_id="ACY96188.1"
FT                   /translation="MKNGSRLAALGGVVVAGALALSACGSDDNVGAGASNAPTGKIDCV
FT                   KGTVNAAGASSQKNAIEEWKKIYAQQCAGATLNYNPAGSGAGIQAFLAGQVAFAGSDSA
FT                   LDEQEAARARQRCQGNPAWNLPMVVGPVAVIYNLPGVDGLQLKPKTLAAIFAGKLKKWN
FT                   DPAIAADNPGTDLPDTDIKPIHRSDESGTTENFTDYLSNVAGDEWKWEPEKKWPTEAGG
FT                   QGAPKSDGVVTVLKQTEGGISYVEMSFAKKNGLQTAKIANGSGEYVEVSEQSVGNALDS
FT                   AEIVGQGHDLALKLDYNTSAAGAYPIFLVTYEVVCSKGLPADQAAFVKAFLKYTAGEDG
FT                   QKVLTDAGYAPLSPALAAKVRAAVEALS"
     MKNGSRLAAL GGVVVAGALA LSACGSDDNV GAGASNAPTG KIDCVKGTVN AAGASSQKNA        60
     IEEWKKIYAQ QCAGATLNYN PAGSGAGIQA FLAGQVAFAG SDSALDEQEA ARARQRCQGN       120
     PAWNLPMVVG PVAVIYNLPG VDGLQLKPKT LAAIFAGKLK KWNDPAIAAD NPGTDLPDTD       180
     IKPIHRSDES GTTENFTDYL SNVAGDEWKW EPEKKWPTEA GGQGAPKSDG VVTVLKQTEG       240
     GISYVEMSFA KKNGLQTAKI ANGSGEYVEV SEQSVGNALD SAEIVGQGHD LALKLDYNTS       300
     AAGAYPIFLV TYEVVCSKGL PADQAAFVKA FLKYTAGEDG QKVLTDAGYA PLSPALAAKV       360
     RAAVEALS                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page