(data stored in ACNUC30630 zone)

EMBL: CP001738.PE58

CP001738.PE58        Location/Qualifiers
FT   CDS             complement(60995..61252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0059"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95667"
FT                   /db_xref="GOA:D1ADF7"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADF7"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ACY95667.1"
FT                   /translation="MPKSKVRKKAVYTPPQRSQKAAVSPRWLVPTMLFLWLAGLVWIAT
FT                   FYVTASTATDVPLMSDLGNWNLGIGFGSIILGVILSTRWR"
     MPKSKVRKKA VYTPPQRSQK AAVSPRWLVP TMLFLWLAGL VWIATFYVTA STATDVPLMS        60
     DLGNWNLGIG FGSIILGVIL STRWR                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page