(data stored in ACNUC30630 zone)

EMBL: CP001738.PE590

CP001738.PE590       Location/Qualifiers
FT   CDS             complement(672159..672989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0604"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_4862 adventurous gliding motility
FT                   protein AgmX"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96199"
FT                   /db_xref="GOA:D1A4G4"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4G4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96199.1"
FT                   /translation="MNSGQNAPVNPQQWAPLPPPPGPVGSRRRPWLLPALALAAVLVVG
FT                   AVLAVVVRGGGGGNAAEPPAPMSTASATPTGSGTPAAQAPRFVTITAPCRLVPRPVRRS
FT                   FMPPPLNARRAGPSGRPGQDGHAAGCRWSTANPQAPRQRALTVRVVLRADQGGRAGVDK
FT                   ATTWMNAARRTMRQRAGTSVQNAGGSVLRYGTFRRVPDVGEDAFAMYAEAQSAAGRTGS
FT                   VTVWARYANAMFKVVFAGSDGGAVPLAETAAFEGATAAARAVVTALQGCTGCLG"
     MNSGQNAPVN PQQWAPLPPP PGPVGSRRRP WLLPALALAA VLVVGAVLAV VVRGGGGGNA        60
     AEPPAPMSTA SATPTGSGTP AAQAPRFVTI TAPCRLVPRP VRRSFMPPPL NARRAGPSGR       120
     PGQDGHAAGC RWSTANPQAP RQRALTVRVV LRADQGGRAG VDKATTWMNA ARRTMRQRAG       180
     TSVQNAGGSV LRYGTFRRVP DVGEDAFAMY AEAQSAAGRT GSVTVWARYA NAMFKVVFAG       240
     SDGGAVPLAE TAAFEGATAA ARAVVTALQG CTGCLG                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page