(data stored in ACNUC30630 zone)

EMBL: CP001738.PE591

CP001738.PE591       Location/Qualifiers
FT   CDS             673335..674630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0605"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: dat:HRM2_26400 putative alkaline serine
FT                   protease (subtilase family protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96200"
FT                   /db_xref="GOA:D1A4G5"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4G5"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ACY96200.1"
FT                   /translation="MKARRVAWGAIALVAVQLLTCPAALAAPSPDPSQRSTPKPGGTPE
FT                   PKPSKKKSPSPQPPPQRETKQECEIKTGIPAGQLQEEPWAQKRLGFTAVWELTTGKGVT
FT                   VAVVDSGVDASHPQLKGRVRTIDVTGTGTRDCLGHGTQAAGIIAARDMRRRQVPFLGVA
FT                   PGVRLLSIKAAVQQSGNDPGWTAKAIREAADRGAKVINVSSQSPDYPSLREAVKYAQRK
FT                   DAVIVAAAGNIQDEQRGTQTPAYPAAYPGVVAVGAVGESATLSSFSNTETPVTVVAPGE
FT                   KIVSTWPGGGYNIDQGTSFATPFVSGVAALVRSYHPKLSYKQVKRRLEVTADGGSANGT
FT                   GGGMVNPLQAVTAVLDGEEEGEEAPSPQALPVYIPRPEPEDRFGRTLALSLTGGALALA
FT                   ASAVAAGIIIPAGRRRNWRPSRRQPSTEGPTG"
     MKARRVAWGA IALVAVQLLT CPAALAAPSP DPSQRSTPKP GGTPEPKPSK KKSPSPQPPP        60
     QRETKQECEI KTGIPAGQLQ EEPWAQKRLG FTAVWELTTG KGVTVAVVDS GVDASHPQLK       120
     GRVRTIDVTG TGTRDCLGHG TQAAGIIAAR DMRRRQVPFL GVAPGVRLLS IKAAVQQSGN       180
     DPGWTAKAIR EAADRGAKVI NVSSQSPDYP SLREAVKYAQ RKDAVIVAAA GNIQDEQRGT       240
     QTPAYPAAYP GVVAVGAVGE SATLSSFSNT ETPVTVVAPG EKIVSTWPGG GYNIDQGTSF       300
     ATPFVSGVAA LVRSYHPKLS YKQVKRRLEV TADGGSANGT GGGMVNPLQA VTAVLDGEEE       360
     GEEAPSPQAL PVYIPRPEPE DRFGRTLALS LTGGALALAA SAVAAGIIIP AGRRRNWRPS       420
     RRQPSTEGPT G                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page